AK4 Antikörper (Middle Region)
-
- Target Alle AK4 Antikörper anzeigen
- AK4 (Adenylate Kinase 4 (AK4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AK4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AK3 L1 antibody was raised against the middle region of AK3 1
- Aufreinigung
- Purified
- Immunogen
- AK3 L1 antibody was raised using the middle region of AK3 1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK
- Top Product
- Discover our top product AK4 Primärantikörper
-
anti-Adenylate Kinase 4 (AK4) (AA 119-153) antibody
AK4 Reaktivität: Human, Maus WB, IF, IHC (p) Wirt: Kaninchen Polyclonal RB48826 unconjugated
anti-Adenylate Kinase 4 (AK4) (AA 1-223) antibodyAK4 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Adenylate Kinase 4 (AK4) antibodyAK4 Reaktivität: Human, Affe WB, IHC, IF, FACS, IHC (p) Wirt: Maus Monoclonal 5E7 unconjugated
anti-Adenylate Kinase 4 (AK4) antibodyAK4 Reaktivität: Human, Maus, Ratte, Hund, Affe WB, IHC, IF, FACS, IHC (p) Wirt: Maus Monoclonal 3B1 unconjugated
anti-Adenylate Kinase 4 (AK4) antibodyAK4 Reaktivität: Human, Hund, Affe WB, IHC, IF, FACS, IHC (p) Wirt: Maus Monoclonal 2B12 unconjugated
anti-Adenylate Kinase 4 (AK4) (AA 1-223) antibodyAK4 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Adenylate Kinase 4 (AK4) antibodyAK4 Reaktivität: Human WB, IHC, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Adenylate Kinase 4 (AK4) antibodyAK4 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Adenylate Kinase 4 (AK4) (Internal Region) antibodyAK4 Reaktivität: Human, Maus, Ratte WB, IHC, IF, ELISA, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Adenylate Kinase 4 (AK4) antibodyAK4 Reaktivität: Human, Maus, Ratte WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AK3L1 Blocking Peptide, catalog no. 33R-8265, is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AK4 (Adenylate Kinase 4 (AK4))
- Andere Bezeichnung
- AK3L1 (AK4 Produkte)
- Synonyme
- AK 4 antikoerper, AK3 antikoerper, AK3L1 antikoerper, AK3L2 antikoerper, ak3l1 antikoerper, wu:fc37g02 antikoerper, zgc:85790 antikoerper, AK4 antikoerper, Ak-3 antikoerper, Ak-4 antikoerper, Ak3 antikoerper, Ak3l1 antikoerper, D4Ertd274e antikoerper, Ak3l2 antikoerper, adenylate kinase 4 antikoerper, AK4 antikoerper, ak4 antikoerper, Ak4 antikoerper, ADK4 antikoerper
- Hintergrund
- AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-
