MDH2 Antikörper
-
- Target Alle MDH2 Antikörper anzeigen
- MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MDH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
- Top Product
- Discover our top product MDH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MDH2 Blocking Peptide, catalog no. 33R-9388, is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))
- Andere Bezeichnung
- MDH2 (MDH2 Produkte)
- Synonyme
- Mdh2b antikoerper, m-mdh antikoerper, mdh2 antikoerper, mor1 antikoerper, MDH-2 antikoerper, Mdh antikoerper, wu:fj48c08 antikoerper, wu:fj55d06 antikoerper, zgc:64133 antikoerper, M-MDH antikoerper, MDH antikoerper, MGC:3559 antikoerper, MOR1 antikoerper, MMDH antikoerper, Mdh-2 antikoerper, Mor-1 antikoerper, Mor1 antikoerper, malate dehydrogenase 2 S homeolog antikoerper, malate dehydrogenase 2 antikoerper, Malate dehydrogenase 2 antikoerper, malate dehydrogenase antikoerper, malate dehydrogenase 2, NAD (mitochondrial) antikoerper, mdh2.S antikoerper, MDH2 antikoerper, Mdh2 antikoerper, MDH4 antikoerper, mdh2 antikoerper
- Hintergrund
- Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.
- Molekulargewicht
- 33 kDa (MW of target protein)
-