ATP5B Antikörper (C-Term)
-
- Target Alle ATP5B Antikörper anzeigen
- ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP5B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATP5 B antibody was raised against the C terminal of ATP5
- Aufreinigung
- Purified
- Immunogen
- ATP5 B antibody was raised using the C terminal of ATP5 corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
- Top Product
- Discover our top product ATP5B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP5B Blocking Peptide, catalog no. 33R-6043, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))
- Andere Bezeichnung
- ATP5B (ATP5B Produkte)
- Synonyme
- atpmb antikoerper, atpsb antikoerper, Atpsyn-beta antikoerper, hm:zehn0534 antikoerper, im:6793121 antikoerper, wu:fj38d01 antikoerper, zgc:111961 antikoerper, ATPMB antikoerper, ATPSB antikoerper, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide antikoerper, ATP synthase subunit beta, mitochondrial antikoerper, ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit antikoerper, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog antikoerper, ATP5B antikoerper, atp5b antikoerper, Atp5b antikoerper, LOC100401662 antikoerper, LOC100635763 antikoerper, atp5b.S antikoerper
- Hintergrund
- ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-