IDH3A Antikörper

Produktnummer ABIN629675

Produktdetails anti-IDH3A Antikörper

Target: IDH3A (Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDH3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: IDH3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IDH3A Blocking Peptide, catalog no. 33R-6142, is also available for use as a blocking control in assays to test for specificity of this IDH3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IDH3A

Target: IDH3A (Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A))

Andere Bezeichnung: IDH3A (IDH3A Produkte)

Synonyme: idh3a antikoerper, MGC76128 antikoerper, IDH3A antikoerper, zgc:56380 antikoerper, zgc:85631 antikoerper, BG1 antikoerper, 1110003P10Rik antikoerper, 1500012E04Rik antikoerper, AA407078 antikoerper, AI316514 antikoerper, isocitrate dehydrogenase 3 (NAD+) alpha antikoerper, isocitrate dehydrogenase 3 (NAD(+)) alpha antikoerper, isocitrate dehydrogenase 3 (NAD+) alpha S homeolog antikoerper, idh3a antikoerper, IDH3A antikoerper, idh3a.S antikoerper, Idh3a antikoerper

Hintergrund: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit.

Molekulargewicht: 40 kDa (MW of target protein)