ALDH4A1 Antikörper (N-Term)
-
- Target Alle ALDH4A1 Antikörper anzeigen
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH4A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ALDH4 A1 antibody was raised against the N terminal of ALDH4 1
- Aufreinigung
- Purified
- Immunogen
- ALDH4 A1 antibody was raised using the N terminal of ALDH4 1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL
- Top Product
- Discover our top product ALDH4A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDH4A1 Blocking Peptide, catalog no. 33R-7563, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
- Andere Bezeichnung
- ALDH4A1 (ALDH4A1 Produkte)
- Hintergrund
- ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-