ALDH4A1 Antikörper (N-Term)

Produktnummer ABIN629678

Produktdetails anti-ALDH4A1 Antikörper

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH4A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ALDH4 A1 antibody was raised against the N terminal of ALDH4 1

Aufreinigung: Purified

Immunogen: ALDH4 A1 antibody was raised using the N terminal of ALDH4 1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH4A1 Blocking Peptide, catalog no. 33R-7563, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH4A1

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Andere Bezeichnung: ALDH4A1 (ALDH4A1 Produkte)

Synonyme: aldh4 antikoerper, p5cd antikoerper, p5cdh antikoerper, ALDH4 antikoerper, P5CD antikoerper, P5CDh antikoerper, A930035F14Rik antikoerper, Ahd-1 antikoerper, Ahd1 antikoerper, Aldh4 antikoerper, Aldh5a1 antikoerper, E330022C09 antikoerper, P5cd antikoerper, P5cdh antikoerper, P5cdhl antikoerper, P5cdhs antikoerper, Ssdh1 antikoerper, zgc:63592 antikoerper, aldehyde dehydrogenase 4 family member A1 antikoerper, aldehyde dehydrogenase 4 family, member A1 antikoerper, aldehyde dehydrogenase 4 family member A1 L homeolog antikoerper, aldh4a1 antikoerper, ALDH4A1 antikoerper, Aldh4a1 antikoerper, aldh4a1.L antikoerper

Hintergrund: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process