CPS1 Antikörper (N-Term)
-
- Target Alle CPS1 Antikörper anzeigen
- CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CPS1 antibody was raised against the N terminal of CPS1
- Aufreinigung
- Purified
- Immunogen
- CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
- Top Product
- Discover our top product CPS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CPS1 Blocking Peptide, catalog no. 33R-7787, is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))
- Andere Bezeichnung
- CPS1 (CPS1 Produkte)
- Hintergrund
- Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.
- Molekulargewicht
- 165 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Cellular Glucan Metabolic Process
-