CPS1 Antikörper (N-Term)

Produktnummer ABIN629684

Produktdetails anti-CPS1 Antikörper

Target: CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CPS1 antibody was raised against the N terminal of CPS1

Aufreinigung: Purified

Immunogen: CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPS1 Blocking Peptide, catalog no. 33R-7787, is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPS1

Target: CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))

Andere Bezeichnung: CPS1 (CPS1 Produkte)

Synonyme: CPSASE1 antikoerper, cps antikoerper, 4732433M03Rik antikoerper, CPS antikoerper, D1Ucla3 antikoerper, Cps1 antikoerper, carbamoyl-phosphate synthase 1 antikoerper, carbamoyl-phosphate synthase 1 L homeolog antikoerper, carbamoyl-phosphate synthetase 1 antikoerper, peptidase M20 domain containing 1 antikoerper, CPS1 antikoerper, Cps1 antikoerper, cps1.L antikoerper, cps1 antikoerper, PM20D1 antikoerper

Hintergrund: Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.

Molekulargewicht: 165 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Glucan Metabolic Process