NDUFV1 Antikörper
-
- Target Alle NDUFV1 Antikörper anzeigen
- NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDUFV1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
- Top Product
- Discover our top product NDUFV1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDUFV1 Blocking Peptide, catalog no. 33R-2999, is also available for use as a blocking control in assays to test for specificity of this NDUFV1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))
- Andere Bezeichnung
- NDUFV1 (NDUFV1 Produkte)
- Synonyme
- GB17095 antikoerper, uqor1 antikoerper, DDBDRAFT_0188174 antikoerper, DDBDRAFT_0191420 antikoerper, DDB_0188174 antikoerper, DDB_0191420 antikoerper, wu:fc01f01 antikoerper, wu:fc12f12 antikoerper, zgc:86620 antikoerper, CI-51kD antikoerper, CI-51K antikoerper, CI51KD antikoerper, UQOR1 antikoerper, NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial antikoerper, NADH:ubiquinone oxidoreductase core subunit V1 antikoerper, NADH dehydrogenase ubiquinone flavoprotein 1 antikoerper, NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa antikoerper, NADH dehydrogenase (ubiquinone) flavoprotein 1 antikoerper, NADH:ubiquinone oxidoreductase core subunit V1 L homeolog antikoerper, LOC408367 antikoerper, NDUFV1 antikoerper, ndufv1 antikoerper, Ndufv1 antikoerper, LOC100179486 antikoerper, ndufv1.L antikoerper
- Hintergrund
- The NDUFV1 gene encodes the 51 kDa subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.
- Molekulargewicht
- 51 kDa (MW of target protein)
-