PPIF Antikörper
-
- Target Alle PPIF Antikörper anzeigen
- PPIF (Peptidylprolyl Isomerase F (PPIF))
-
Reaktivität
- Human, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPIF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
- Top Product
- Discover our top product PPIF Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPIF Blocking Peptide, catalog no. 33R-3589, is also available for use as a blocking control in assays to test for specificity of this PPIF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIF (Peptidylprolyl Isomerase F (PPIF))
- Andere Bezeichnung
- PPIF (PPIF Produkte)
- Hintergrund
- PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
- Molekulargewicht
- 19 kDa (MW of target protein)
- Pathways
- Proton Transport, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity
-