PCK1 Antikörper (Soluble)
-
- Target Alle PCK1 Antikörper anzeigen
- PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
-
Bindungsspezifität
- Soluble
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
- Top Product
- Discover our top product PCK1 Primärantikörper
-
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (AA 592-622), (C-Term) antibody
PCK1 Reaktivität: Human, Maus, Ratte WB, IHC (p), IF Wirt: Kaninchen Polyclonal RB03646 unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (AA 1-622) antibodyPCK1 Reaktivität: Human WB, ELISA, IP, IF Wirt: Maus Monoclonal 3E4 unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (C-Term) antibodyPCK1 Reaktivität: Human WB, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (Middle Region) antibodyPCK1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Kaninchen, Pferd, Schwein, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (AA 312-563) antibodyPCK1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (Middle Region) antibodyPCK1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Kaninchen, Pferd, Schwein, Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) antibodyPCK1 Reaktivität: Human, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (AA 40-70), (N-Term) antibodyPCK1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB3644 unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (C-Term) antibodyPCK1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) (AA 330-379) antibodyPCK1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Pferd, Affe, Huhn, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCK1 Blocking Peptide, catalog no. 33R-6700, is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
- Andere Bezeichnung
- PCK1 (PCK1 Produkte)
- Hintergrund
- PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.
- Molekulargewicht
- 69 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis
-
