PCK1 Antikörper (Soluble)

Produktnummer ABIN629697

Produktdetails anti-PCK1 Antikörper

Target: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Bindungsspezifität: Soluble

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCK1 Blocking Peptide, catalog no. 33R-6700, is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCK1

Target: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Andere Bezeichnung: PCK1 (PCK1 Produkte)

Synonyme: PEPCK-C antikoerper, PEPCK1 antikoerper, PEPCKC antikoerper, PEPCK antikoerper, PEPCK-M antikoerper, PEPCK2 antikoerper, 1810010O14Rik antikoerper, 9130022B02Rik antikoerper, cb856 antikoerper, cb924 antikoerper, fj93h11 antikoerper, zgc:63869 antikoerper, wu:fc51c05 antikoerper, wu:fj93h11 antikoerper, pepck-c antikoerper, pepck1 antikoerper, pepckc antikoerper, PCK1 antikoerper, PPCK1 antikoerper, AI265463 antikoerper, Pck-1 antikoerper, GTP antikoerper, PCK antikoerper, Pepck antikoerper, RATPEPCK antikoerper, Ppc1C antikoerper, PHOSPHOENOLPYRUVATE CARBOXYKINASE antikoerper, T28I19.150 antikoerper, T28I19_150 antikoerper, phosphoenolpyruvate carboxykinase 1 antikoerper, 143299_at antikoerper, CG10924 antikoerper, CG17725 antikoerper, Dmel\\CG17725 antikoerper, Dromel_CG17725_FBtr0086701_pepck_mORF antikoerper, dPEPCK antikoerper, pepck antikoerper, PEPC antikoerper, PEPCase antikoerper, ppc antikoerper, phosphoenolpyruvate carboxykinase 1 antikoerper, phosphoenolpyruvate carboxykinase 2, mitochondrial antikoerper, phosphoenolpyruvate carboxykinase 2 (mitochondrial) antikoerper, phosphoenolpyruvate carboxykinase 1 (soluble) antikoerper, phosphoenolpyruvate carboxykinase 1 S homeolog antikoerper, phosphoenolpyruvate carboxykinase, cytosolic [GTP] antikoerper, phosphoenolpyruvate carboxykinase 1, cytosolic antikoerper, phosphoenolpyruvate carboxylase 7 antikoerper, Phosphoenolpyruvate carboxykinase antikoerper, phosphoenolpyruvate carboxylase antikoerper, PCK1 antikoerper, PCK2 antikoerper, Pck2 antikoerper, pck1 antikoerper, pck1.S antikoerper, LOC100634531 antikoerper, Pck1 antikoerper, pep7 antikoerper, Pepck antikoerper, LOC107777405 antikoerper

Hintergrund: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis