UXT Antikörper (N-Term)
-
- Target Alle UXT Antikörper anzeigen
- UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UXT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UXT antibody was raised against the N terminal of UXT
- Aufreinigung
- Purified
- Immunogen
- UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
- Top Product
- Discover our top product UXT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UXT Blocking Peptide, catalog no. 33R-5785, is also available for use as a blocking control in assays to test for specificity of this UXT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))
- Andere Bezeichnung
- UXT (UXT Produkte)
- Hintergrund
- UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.
- Molekulargewicht
- 18 kDa (MW of target protein)
- Pathways
- Unfolded Protein Response
-