CDR2 Antikörper (N-Term)

Produktnummer ABIN629700

Produktdetails anti-CDR2 Antikörper

Target: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDR2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: CDR2 antibody was raised against the N terminal of CDR2

Aufreinigung: Purified

Immunogen: CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDR2 Blocking Peptide, catalog no. 33R-6176, is also available for use as a blocking control in assays to test for specificity of this CDR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDR2

Target: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Andere Bezeichnung: CDR2 (CDR2 Produkte)

Synonyme: CDR62 antikoerper, Yo antikoerper, cdr2 antikoerper, MGC69206 antikoerper, CDR2 antikoerper, AA617262 antikoerper, RGD1310578 antikoerper, cerebellar degeneration related protein 2 antikoerper, cerebellar degeneration related protein 2 L homeolog antikoerper, cerebellar degeneration-related 2 antikoerper, cerebellar degeneration-related protein 2 antikoerper, cerebellar degeneration related protein 2 like antikoerper, CDR2 antikoerper, cdr2 antikoerper, cdr2.L antikoerper, Cdr2 antikoerper, CDR2L antikoerper, LOC101060399 antikoerper

Hintergrund: Cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.

Molekulargewicht: 52 kDa (MW of target protein)