RGS20 Antikörper (N-Term)
-
- Target Alle RGS20 Antikörper anzeigen
- RGS20 (Regulator of G-Protein Signaling 20 (RGS20))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RGS20 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RGS20 antibody was raised against the N terminal of RGS20
- Aufreinigung
- Purified
- Immunogen
- RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP
- Top Product
- Discover our top product RGS20 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RGS20 Blocking Peptide, catalog no. 33R-4413, is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS20 (Regulator of G-Protein Signaling 20 (RGS20))
- Andere Bezeichnung
- RGS20 (RGS20 Produkte)
- Synonyme
- RGSZ1 antikoerper, ZGAP1 antikoerper, zgc:92650 antikoerper, rgsz1 antikoerper, zgap1 antikoerper, GzGAP antikoerper, RSG20 antikoerper, 2900073E09Rik antikoerper, Rgsz1 antikoerper, regulator of G protein signaling 20 antikoerper, regulator of G-protein signaling 20 L homeolog antikoerper, regulator of G-protein signaling 20 antikoerper, RGS20 antikoerper, rgs20 antikoerper, rgs20.L antikoerper, Rgs20 antikoerper
- Hintergrund
- Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-