FECH Antikörper

Produktnummer ABIN629703

Produktdetails anti-FECH Antikörper

Target: FECH (Ferrochelatase (FECH))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FECH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FECH Blocking Peptide, catalog no. 33R-4860, is also available for use as a blocking control in assays to test for specificity of this FECH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FECH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FECH

Target: FECH (Ferrochelatase (FECH))

Andere Bezeichnung: FECH (FECH Produkte)

Synonyme: AI894116 antikoerper, Fcl antikoerper, fch antikoerper, zgc:109851 antikoerper, EPP antikoerper, FCE antikoerper, CG2098 antikoerper, Dmel\\CG2098 antikoerper, GB15952 antikoerper, ferrochelatase L homeolog antikoerper, ferrochelatase antikoerper, Ferrochelatase antikoerper, ferrochelatase, mitochondrial antikoerper, ferrochelatase HemH antikoerper, ferrochelatase (predicted) antikoerper, fech.L antikoerper, hemH antikoerper, Fech antikoerper, FECH antikoerper, fech antikoerper, FeCH antikoerper, LOC409922 antikoerper, hem15 antikoerper, APH_RS01140 antikoerper

Hintergrund: Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis