FDFT1 Antikörper (N-Term)
-
- Target Alle FDFT1 Antikörper anzeigen
- FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FDFT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FDFT1 antibody was raised against the N terminal of FDFT1
- Aufreinigung
- Purified
- Immunogen
- FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM
- Top Product
- Discover our top product FDFT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FDFT1 Blocking Peptide, catalog no. 33R-3852, is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDFT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))
- Andere Bezeichnung
- FDFT1 (FDFT1 Produkte)
- Synonyme
- FDFT1 antikoerper, DKFZp459C1712 antikoerper, SQS antikoerper, SS antikoerper, DGPT antikoerper, ERG9 antikoerper, fdft1 antikoerper, farnesyl-diphosphate farnesyltransferase 1 antikoerper, squalene synthase antikoerper, farnesyl diphosphate farnesyl transferase 1 antikoerper, FDFT1 antikoerper, fdft1 antikoerper, LOC100560926 antikoerper, Fdft1 antikoerper
- Hintergrund
- FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-