ASS1 Antikörper (C-Term)
-
- Target Alle ASS1 Antikörper anzeigen
- ASS1 (Argininosuccinate Synthase 1 (ASS1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ASS1 antibody was raised against the C terminal Of Ass
- Aufreinigung
- Purified
- Immunogen
- ASS1 antibody was raised using the C terminal Of Ass corresponding to a region with amino acids SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
- Top Product
- Discover our top product ASS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASS1 Blocking Peptide, catalog no. 33R-8918, is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASS1 (Argininosuccinate Synthase 1 (ASS1))
- Andere Bezeichnung
- ASS1 (ASS1 Produkte)
- Synonyme
- ASS antikoerper, CTLN1 antikoerper, AA408052 antikoerper, Ass-1 antikoerper, fold antikoerper, ASSA antikoerper, Ass antikoerper, ass antikoerper, zgc:92051 antikoerper, wu:fb95a04 antikoerper, wu:fc01e08 antikoerper, argininosuccinate synthase 1 antikoerper, argininosuccinate synthetase 1 antikoerper, argininosuccinate synthase 1 S homeolog antikoerper, ASS1 antikoerper, Ass1 antikoerper, ass1.S antikoerper, ass1 antikoerper
- Hintergrund
- ASS catalyzes the penultimate step of the arginine biosynthetic pathway.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin
-