HMGCS2 Antikörper

Produktnummer ABIN629710

Produktdetails anti-HMGCS2 Antikörper

Target: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCS2 Blocking Peptide, catalog no. 33R-7166, is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCS2

Target: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Andere Bezeichnung: HMGCS2 (HMGCS2 Produkte)

Synonyme: 1300002P16 antikoerper, mHS antikoerper, DDBDRAFT_0219349 antikoerper, DDBDRAFT_0219924 antikoerper, DDB_0219349 antikoerper, DDB_0219924 antikoerper, Hmgcs1 antikoerper, Mt3h3mg antikoerper, hmgCoA antikoerper, 3-hydroxy-3-methylglutaryl-CoA synthase 2 antikoerper, 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 antikoerper, hydroxymethylglutaryl-CoA synthase antikoerper, hydroxymethylglutaryl-coa synthase antikoerper, 3-HYDROXY-3-METHYLGLUTARYL-CoA SYNTHASE 2 antikoerper, HMGCS2 antikoerper, Hmgcs2 antikoerper, mvaS antikoerper, CNC05080 antikoerper, HMCS1 antikoerper, hgsA antikoerper, MFER_RS00425 antikoerper, LOC100285783 antikoerper, ECU10_0510 antikoerper, Eint_100450 antikoerper

Hintergrund: HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha