FTCD Antikörper (N-Term)

Produktnummer ABIN629713

Produktdetails anti-FTCD Antikörper

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FTCD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FTCD antibody was raised against the N terminal of FTCD

Aufreinigung: Purified

Immunogen: FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTCD Blocking Peptide, catalog no. 33R-3055, is also available for use as a blocking control in assays to test for specificity of this FTCD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTCD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FTCD

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Andere Bezeichnung: FTCD (FTCD Produkte)

Synonyme: LCHC1 antikoerper, FTCD antikoerper, wu:fp37b11 antikoerper, zgc:63647 antikoerper, formimidoyltransferase cyclodeaminase antikoerper, formiminotransferase cyclodeaminase antikoerper, formiminotransferase-cyclodeaminase antikoerper, formimidoyltransferase cyclodeaminase L homeolog antikoerper, FTCD antikoerper, Ftcd antikoerper, ftcd antikoerper, DP2350 antikoerper, Cbei_0990 antikoerper, TRQ2_1223 antikoerper, GAU_0899 antikoerper, ftcd.L antikoerper

Hintergrund: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Molekulargewicht: 60 kDa (MW of target protein)