LIM Domain Binding 3 Protein Antikörper (N-Term)

Produktnummer ABIN629714

Produktdetails anti-LIM Domain Binding 3 Protein Antikörper

Target: LIM Domain Binding 3 Protein (LDB3) (LIM Domain Binding 3 (LDB3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIM Domain Binding 3 Protein Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LDB3 antibody was raised against the N terminal of LDB3

Aufreinigung: Purified

Immunogen: LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDB3 Blocking Peptide, catalog no. 33R-7412, is also available for use as a blocking control in assays to test for specificity of this LDB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIM Domain Binding 3 Protein

Target: LIM Domain Binding 3 Protein (LDB3) (LIM Domain Binding 3 (LDB3))

Andere Bezeichnung: LDB3 (LDB3 Produkte)

Hintergrund: LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.

Molekulargewicht: 36 kDa (MW of target protein)