RSU1 Antikörper (C-Term)
-
- Target Alle RSU1 Antikörper anzeigen
- RSU1 (Ras Suppressor Protein 1 (RSU1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RSU1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RSU1 antibody was raised against the C terminal of RSU1
- Aufreinigung
- Purified
- Immunogen
- RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK
- Top Product
- Discover our top product RSU1 Primärantikörper
-
anti-Ras Suppressor Protein 1 (RSU1) antibody
RSU1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 2-277) antibodyRSU1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 178-277) antibodyRSU1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3F10 unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 1-277) antibodyRSU1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1C6 unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (C-Term) antibodyRSU1 Reaktivität: Human, Maus WB, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (C-Term) antibodyRSU1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Huhn, Hamster, Affe, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (C-Term) antibodyRSU1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Schaf, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 117-277) antibodyRSU1 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 1-277) antibodyRSU1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) antibodyRSU1 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RSU1 Blocking Peptide, catalog no. 33R-7149, is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSU1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSU1 (Ras Suppressor Protein 1 (RSU1))
- Andere Bezeichnung
- RSU1 (RSU1 Produkte)
- Synonyme
- etID12695 antikoerper, si:dz63m2.1 antikoerper, RSP-1 antikoerper, RsuI antikoerper, rsp-1 antikoerper, Ras suppressor protein 1 antikoerper, Ras suppressor protein 1 S homeolog antikoerper, rsu1 antikoerper, rsu1.S antikoerper, RSU1 antikoerper, Rsu1 antikoerper
- Hintergrund
- RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.
- Molekulargewicht
- 31 kDa (MW of target protein)
-
