Asialoglycoprotein Receptor 2 Antikörper (N-Term)

Produktnummer ABIN629718

Produktdetails anti-Asialoglycoprotein Receptor 2 Antikörper

Target: Asialoglycoprotein Receptor 2 (ASGR2)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Asialoglycoprotein Receptor 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ASGR2 antibody was raised against the N terminal of ASGR2

Aufreinigung: Purified

Immunogen: ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV

Anwendungsinformationen

Applikationshinweise: WB: 4 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASGR2 Blocking Peptide, catalog no. 33R-8876, is also available for use as a blocking control in assays to test for specificity of this ASGR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Asialoglycoprotein Receptor 2

Target: Asialoglycoprotein Receptor 2 (ASGR2)

Andere Bezeichnung: ASGR2 (ASGR2 Produkte)

Synonyme: ASGR2 antikoerper, asgr2 antikoerper, MGC137129 antikoerper, ASGP-R2 antikoerper, ASGPR2 antikoerper, CLEC4H2 antikoerper, HBXBP antikoerper, HL-2 antikoerper, Asgr antikoerper, Asgr-2 antikoerper, asialoglycoprotein receptor 2 antikoerper, C-type lectin domain family 10 member A antikoerper, ASGR2 antikoerper, clec10a antikoerper, Asgr2 antikoerper, LOC100347178 antikoerper

Hintergrund: ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis