MAT1A Antikörper (C-Term)
-
- Target Alle MAT1A Antikörper anzeigen
- MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAT1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAT1 A antibody was raised against the C terminal of MAT1
- Aufreinigung
- Purified
- Immunogen
- MAT1 A antibody was raised using the C terminal of MAT1 corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
- Top Product
- Discover our top product MAT1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAT1A Blocking Peptide, catalog no. 33R-9422, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))
- Andere Bezeichnung
- MAT1A (MAT1A Produkte)
- Hintergrund
- MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process
-