UBE2N Antikörper
-
- Target Alle UBE2N Antikörper anzeigen
- UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))
-
Reaktivität
- Human, Ratte, Maus, Zebrafisch (Danio rerio), Hund, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2N Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE
- Top Product
- Discover our top product UBE2N Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2N Blocking Peptide, catalog no. 33R-3532, is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))
- Andere Bezeichnung
- UBE2N (UBE2N Produkte)
- Hintergrund
- UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway
-