UBE2K Antikörper (N-Term)
-
- Target Alle UBE2K Antikörper anzeigen
- UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2K Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HIP2 antibody was raised against the N terminal of HIP2
- Aufreinigung
- Purified
- Immunogen
- HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP
- Top Product
- Discover our top product UBE2K Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HIP2 Blocking Peptide, catalog no. 33R-5707, is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))
- Andere Bezeichnung
- HIP2 (UBE2K Produkte)
- Hintergrund
- HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.
- Molekulargewicht
- 22 kDa (MW of target protein)
-