UBE2K Antikörper (N-Term)

Produktnummer ABIN629721

Produktdetails anti-UBE2K Antikörper

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2K Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HIP2 antibody was raised against the N terminal of HIP2

Aufreinigung: Purified

Immunogen: HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HIP2 Blocking Peptide, catalog no. 33R-5707, is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2K

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Andere Bezeichnung: HIP2 (UBE2K Produkte)

Synonyme: E2-25K antikoerper, HIP2 antikoerper, HYPG antikoerper, LIG antikoerper, UBC1 antikoerper, E2-25k antikoerper, Hip2 antikoerper, Hypg antikoerper, Lig antikoerper, e2-25k antikoerper, hip2 antikoerper, hypg antikoerper, lig antikoerper, AW492011 antikoerper, D5Ertd601e antikoerper, ube2k antikoerper, zgc:103472 antikoerper, zgc:110791 antikoerper, ubiquitin conjugating enzyme E2 K antikoerper, ubiquitin-conjugating enzyme E2K antikoerper, ubiquitin conjugating enzyme E2 K S homeolog antikoerper, ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) antikoerper, ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, yeast) antikoerper, UBE2K antikoerper, Ube2k antikoerper, ube2k.S antikoerper, ube2k antikoerper, ube2kb antikoerper, ube2ka antikoerper

Hintergrund: HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Molekulargewicht: 22 kDa (MW of target protein)