AMFR Antikörper (C-Term)

Produktnummer ABIN629722

Produktdetails anti-AMFR Antikörper

Target: AMFR (Autocrine Motility Factor Receptor (AMFR))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMFR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AMFR antibody was raised against the C terminal of AMFR

Aufreinigung: Purified

Immunogen: AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMFR Blocking Peptide, catalog no. 33R-2901, is also available for use as a blocking control in assays to test for specificity of this AMFR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMFR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMFR

Target: AMFR (Autocrine Motility Factor Receptor (AMFR))

Andere Bezeichnung: AMFR (AMFR Produkte)

Synonyme: GP78 antikoerper, RNF45 antikoerper, gp78 antikoerper, wu:fi06e06 antikoerper, wu:fi37e05 antikoerper, zgc:63893 antikoerper, rnf45 antikoerper, autocrine motility factor receptor antikoerper, autocrine motility factor receptor L homeolog antikoerper, autocrine motility factor receptor a antikoerper, autocrine motility factor receptor, amfr antikoerper, putative autocrine motility factor receptor, amfr antikoerper, AMFR antikoerper, Amfr antikoerper, amfr.L antikoerper, amfra antikoerper, amfr antikoerper, AaeL_AAEL005881 antikoerper, CpipJ_CPIJ016043 antikoerper, Smp_047420 antikoerper

Hintergrund: Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling