RNF165 Antikörper (N-Term)
-
- Target Alle RNF165 Antikörper anzeigen
- RNF165 (Ring Finger Protein 165 (RNF165))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF165 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF165 antibody was raised against the N terminal of RNF165
- Aufreinigung
- Purified
- Immunogen
- RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP
- Top Product
- Discover our top product RNF165 Primärantikörper
-
anti-Ring Finger Protein 165 (RNF165) (Middle Region) antibody
RNF165 Reaktivität: Human, Maus, Ratte, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (Middle Region) antibodyRNF165 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (AA 3-31), (N-Term) antibodyRNF165 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37753 unconjugated
anti-Ring Finger Protein 165 (RNF165) (N-Term) antibodyRNF165 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Kaninchen, Huhn, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (AA 201-250) antibodyRNF165 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Huhn, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF165 Blocking Peptide, catalog no. 33R-6596, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF165 (Ring Finger Protein 165 (RNF165))
- Andere Bezeichnung
- RNF165 (RNF165 Produkte)
- Synonyme
- RNF165 antikoerper, ARKL2 antikoerper, 2900024M11Rik antikoerper, AI427432 antikoerper, G630064H08Rik antikoerper, Gm96 antikoerper, RGD1560744 antikoerper, si:ch73-29c22.3 antikoerper, ring finger protein 165 antikoerper, ring finger protein 165a antikoerper, RNF165 antikoerper, Rnf165 antikoerper, rnf165a antikoerper
- Hintergrund
- RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.
- Molekulargewicht
- 39 kDa (MW of target protein)
-
