BSDC1 Antikörper (N-Term)

Produktnummer ABIN629726

Produktdetails anti-BSDC1 Antikörper

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund, Ratte, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BSDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: BSDC1 antibody was raised against the N terminal of BSDC1

Aufreinigung: Purified

Immunogen: BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BSDC1 Blocking Peptide, catalog no. 33R-9610, is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BSDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BSDC1

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Andere Bezeichnung: BSDC1 (BSDC1 Produkte)

Synonyme: BSDC1 antikoerper, fb51h12 antikoerper, wu:fb51h12 antikoerper, zgc:100785 antikoerper, bsdc1 antikoerper, 1110063F24Rik antikoerper, AW011758 antikoerper, RGD1311622 antikoerper, BSD domain containing 1 antikoerper, BSD domain containing 1 L homeolog antikoerper, BSDC1 antikoerper, bsdc1 antikoerper, bsdc1.L antikoerper, Bsdc1 antikoerper

Hintergrund: BSDC1 may be involved in protein binding.

Molekulargewicht: 17 kDa (MW of target protein)