UBR7 Antikörper (C-Term)
-
- Target Alle UBR7 Antikörper anzeigen
- UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBR7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- C14 ORF130 antibody was raised against the C terminal Of C14 rf130
- Aufreinigung
- Purified
- Immunogen
- C14 ORF130 antibody was raised using the C terminal Of C14 rf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED
- Top Product
- Discover our top product UBR7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C14ORF130 Blocking Peptide, catalog no. 33R-2148, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))
- Andere Bezeichnung
- C14ORF130 (UBR7 Produkte)
- Hintergrund
- The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 30 kDa (MW of target protein)
-