UBR7 Antikörper (C-Term)

Produktnummer ABIN629727

Produktdetails anti-UBR7 Antikörper

Target: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBR7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: C14 ORF130 antibody was raised against the C terminal Of C14 rf130

Aufreinigung: Purified

Immunogen: C14 ORF130 antibody was raised using the C terminal Of C14 rf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF130 Blocking Peptide, catalog no. 33R-2148, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBR7

Target: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Andere Bezeichnung: C14ORF130 (UBR7 Produkte)

Synonyme: C14orf130 antikoerper, 5730410I19Rik antikoerper, AA589405 antikoerper, AW557761 antikoerper, RGD1359144 antikoerper, ubiquitin protein ligase E3 component n-recognin 7 (putative) antikoerper, UBR7 antikoerper, Ubr7 antikoerper

Hintergrund: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)