FBXO25 Antikörper (C-Term)

Produktnummer ABIN629736

Produktdetails anti-FBXO25 Antikörper

Target: FBXO25 (F-Box Protein 25 (FBXO25))

Bindungsspezifität: C-Term

Reaktivität: Human, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FBXO25 antibody was raised against the C terminal of FBXO25

Aufreinigung: Purified

Immunogen: FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO25 Blocking Peptide, catalog no. 33R-1290, is also available for use as a blocking control in assays to test for specificity of this FBXO25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO25

Target: FBXO25 (F-Box Protein 25 (FBXO25))

Andere Bezeichnung: FBXO25 (FBXO25 Produkte)

Synonyme: FBXO25 antikoerper, fbxo32 antikoerper, MGC108443 antikoerper, DKFZp469H2437 antikoerper, zgc:100907 antikoerper, FBX25 antikoerper, 9130015I06Rik antikoerper, AI649137 antikoerper, Fbx25 antikoerper, F-box protein 25 antikoerper, F-box protein 25 L homeolog antikoerper, FBXO25 antikoerper, fbxo25 antikoerper, fbxo25.L antikoerper, Fbxo25 antikoerper

Hintergrund: FBXO25 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO25 belongs to the Fbxs class.

Molekulargewicht: 16 kDa (MW of target protein)