FBXL7 Antikörper (N-Term)

Produktnummer ABIN629737

Produktdetails anti-FBXL7 Antikörper

Target: FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXL7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FBXL7 antibody was raised against the N terminal of FBXL7

Aufreinigung: Purified

Immunogen: FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXL7 Blocking Peptide, catalog no. 33R-4136, is also available for use as a blocking control in assays to test for specificity of this FBXL7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXL7

Target: FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))

Andere Bezeichnung: FBXL7 (FBXL7 Produkte)

Synonyme: FBXL7 antikoerper, FBL6 antikoerper, FBL7 antikoerper, AL023057 antikoerper, D230018M15Rik antikoerper, Fbl6 antikoerper, F-box and leucine rich repeat protein 7 antikoerper, F-box and leucine-rich repeat protein 7 antikoerper, FBXL7 antikoerper, Fbxl7 antikoerper

Hintergrund: FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molekulargewicht: 54 kDa (MW of target protein)