LONRF1 Antikörper (N-Term)

Produktnummer ABIN629741

Produktdetails anti-LONRF1 Antikörper

Target: LONRF1 (LON Peptidase N-terminal Domain and Ring Finger 1 (LONRF1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LONRF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: LONRF1 antibody was raised against the N terminal of LONRF1

Aufreinigung: Purified

Immunogen: LONRF1 antibody was raised using the N terminal of LONRF1 corresponding to a region with amino acids MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LONRF1 Blocking Peptide, catalog no. 33R-6504, is also available for use as a blocking control in assays to test for specificity of this LONRF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LONRF1

Target: LONRF1 (LON Peptidase N-terminal Domain and Ring Finger 1 (LONRF1))

Andere Bezeichnung: LONRF1 (LONRF1 Produkte)

Synonyme: RGD1562583 antikoerper, LONRF1 antikoerper, RNF191 antikoerper, LON peptidase N-terminal domain and ring finger 1 antikoerper, LON peptidase N-terminal domain and RING finger protein 1 antikoerper, Lonrf1 antikoerper, LONRF1 antikoerper, LOC567909 antikoerper, lonrf1 antikoerper

Hintergrund: LONRF1 is involved in protein binding, zinc ion binding, ATP-dependent peptidase activity and metal ion binding.

Molekulargewicht: 46 kDa (MW of target protein)