MAT1A Antikörper (N-Term)
-
- Target Alle MAT1A Antikörper anzeigen
- MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAT1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MAT1 A antibody was raised against the N terminal of MAT1
- Aufreinigung
- Purified
- Immunogen
- MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
- Top Product
- Discover our top product MAT1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAT1A Blocking Peptide, catalog no. 33R-9282, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))
- Andere Bezeichnung
- MAT1A (MAT1A Produkte)
- Hintergrund
- MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process
-