DPYS Antikörper (N-Term)

Produktnummer ABIN629746

Produktdetails anti-DPYS Antikörper

Target: DPYS (Dihydropyrimidinase (DPYS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPYS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPYS antibody was raised against the N terminal of DPYS

Aufreinigung: Purified

Immunogen: DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPYS Blocking Peptide, catalog no. 33R-9643, is also available for use as a blocking control in assays to test for specificity of this DPYS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPYS

Target: DPYS (Dihydropyrimidinase (DPYS))

Andere Bezeichnung: DPYS (DPYS Produkte)

Synonyme: DHP antikoerper, DHPase antikoerper, 1200017I10Rik antikoerper, 1300004I01Rik antikoerper, dhp antikoerper, dihydropyrimidinase antikoerper, dihydropyrimidinase L homeolog antikoerper, DPYS antikoerper, Dpys antikoerper, Jann_1488 antikoerper, hydA antikoerper, h16_A3075 antikoerper, Veis_0725 antikoerper, AZC_1966 antikoerper, M446_2543 antikoerper, RSKD131_3628 antikoerper, Vapar_5601 antikoerper, Rleg_5687 antikoerper, LOC9307588 antikoerper, EIO_3239 antikoerper, blr3333 antikoerper, BAV0676 antikoerper, hyuA antikoerper, CtCNB1_2936 antikoerper, dpyS antikoerper, Pat9b_1914 antikoerper, dpys antikoerper, dpys.L antikoerper

Hintergrund: Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

Molekulargewicht: 56 kDa (MW of target protein)