BHMT Antikörper (C-Term)
-
- Target Alle BHMT Antikörper anzeigen
- BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BHMT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- BHMT antibody was raised against the C terminal of BHMT
- Aufreinigung
- Purified
- Immunogen
- BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
- Top Product
- Discover our top product BHMT Primärantikörper
-
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (N-Term) antibody
BHMT Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Rind (Kuh), Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (AA 177-406) antibodyBHMT Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (C-Term) antibodyVerified BHMT Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reaktivität: Human WB, IF, FACS Wirt: Maus Monoclonal 10B3 unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (C-Term) antibodyBHMT Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Rind (Kuh), Kaninchen, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reaktivität: Human IHC, ELISA Wirt: Maus Monoclonal 8C11H5 unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reaktivität: Human WB, IHC (p), IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (C-Term) antibodyBHMT Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (N-Term) antibodyBHMT Reaktivität: Human, Maus, Ratte, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reaktivität: Human, Maus WB, ELISA Wirt: Maus Monoclonal 3D6 unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BHMT Blocking Peptide, catalog no. 33R-4414, is also available for use as a blocking control in assays to test for specificity of this BHMT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))
- Andere Bezeichnung
- BHMT (BHMT Produkte)
- Synonyme
- BHMT1 antikoerper, hm:zehn2153 antikoerper, wu:fb53h01 antikoerper, wu:fb63c08 antikoerper, wu:fj64d01 antikoerper, zgc:123027 antikoerper, betaine--homocysteine S-methyltransferase antikoerper, betaine--homocysteine S-methyltransferase L homeolog antikoerper, betaine-homocysteine methyltransferase antikoerper, betaine-homocysteine S-methyltransferase antikoerper, BHMT antikoerper, bhmt.L antikoerper, Bhmt antikoerper, bhmt antikoerper
- Hintergrund
- BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-
