ASL Antikörper (Middle Region)

Produktnummer ABIN629749

Produktdetails anti-ASL Antikörper

Target: ASL (Argininosuccinate Lyase (ASL))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASL antibody was raised against the middle region of ASL

Aufreinigung: Purified

Immunogen: ASL antibody was raised using the middle region of ASL corresponding to a region with amino acids LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASL Blocking Peptide, catalog no. 33R-5053, is also available for use as a blocking control in assays to test for specificity of this ASL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASL

Target: ASL (Argininosuccinate Lyase (ASL))

Andere Bezeichnung: ASL (ASL Produkte)

Hintergrund: ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus