Cytokeratin 13 Antikörper (C-Term)

Produktnummer ABIN629751

Produktdetails anti-Cytokeratin 13 Antikörper

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytokeratin 13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cytokeratin 13 antibody was raised against the C terminal of KRT13

Aufreinigung: Purified

Immunogen: Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 13 Blocking Peptide, catalog no. 33R-2277, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cytokeratin 13

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Andere Bezeichnung: Cytokeratin 13 (KRT13 Produkte)

Synonyme: krt13 antikoerper, CK13 antikoerper, K13 antikoerper, Ka13 antikoerper, Krt-1.13 antikoerper, Krt1-13 antikoerper, ck13 antikoerper, k13 antikoerper, keratin 24 antikoerper, keratin 13 antikoerper, keratin 13, type I S homeolog antikoerper, krt24 antikoerper, KRT13 antikoerper, Krt13 antikoerper, krt13.S antikoerper, k13 antikoerper

Hintergrund: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.

Molekulargewicht: 46 kDa (MW of target protein)