HAL Antikörper (C-Term)

Produktnummer ABIN629752

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HAL in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für HAL Antikörper (C-Term) (ABIN629752)

Target: HAL (Histidine Ammonia-Lyase (HAL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HAL Antikörper

Bindungsspezifität: C-Term

Spezifität: HAL antibody was raised against the C terminal of HAL

Aufreinigung: Purified

Immunogen: HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAL Blocking Peptide, (ABIN937635), is also available for use as a blocking control in assays to test for specificity of this HAL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAL

Target: HAL (Histidine Ammonia-Lyase (HAL))

Andere Bezeichnung: HAL

Hintergrund: HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluidsHistidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Molekulargewicht: 72 kDa (MW of target protein)