SIK1 Antikörper (N-Term)
-
- Target Alle SIK1 Antikörper anzeigen
- SIK1 (Salt-Inducible Kinase 1 (SIK1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SNF1 LK antibody was raised against the N terminal of SNF1 K
- Aufreinigung
- Purified
- Immunogen
- SNF1 LK antibody was raised using the N terminal of SNF1 K corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
- Top Product
- Discover our top product SIK1 Primärantikörper
-
anti-Salt-Inducible Kinase 1 (SIK1) (AA 567-597), (C-Term) antibody
SIK1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB3576 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-783) antibodySIK1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-100) antibodySIK1 Reaktivität: Human ELISA, IF, IHC (p) Wirt: Maus Monoclonal 2C12 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 492-750) antibodySIK1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-783) antibodySIK1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibodySIK1 Reaktivität: Human, Pferd, Rind (Kuh), Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-101) antibodySIK1 Reaktivität: Human ELISA, IHC, IHC (p) Wirt: Maus Monoclonal 2C12 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibodySIK1 Reaktivität: Human, Maus, Ratte, Pferd, Hund, Meerschweinchen, Rind (Kuh), Schwein, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (Tyr86) antibodySIK1 Reaktivität: Human, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 51-150) antibodySIK1 Reaktivität: Human, Maus WB, ELISA, FACS Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNF1LK Blocking Peptide, catalog no. 33R-6587, is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNF0 K antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIK1 (Salt-Inducible Kinase 1 (SIK1))
- Andere Bezeichnung
- SNF1LK (SIK1 Produkte)
- Synonyme
- Msk antikoerper, Sik antikoerper, Snf1lk antikoerper, SIK2 antikoerper, SNF1LK antikoerper, MSK antikoerper, SIK antikoerper, salt-inducible kinase 1 antikoerper, salt inducible kinase 1 antikoerper, SIK1 antikoerper, Sik1 antikoerper
- Hintergrund
- SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
- Molekulargewicht
- 85 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process
-
