SMPX Antikörper (Middle Region)
-
- Target Alle SMPX Antikörper anzeigen
- SMPX (Small Muscle Protein, X-Linked (SMPX))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMPX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SMPX antibody was raised against the middle region of SMPX
- Aufreinigung
- Purified
- Immunogen
- SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
- Top Product
- Discover our top product SMPX Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMPX Blocking Peptide, catalog no. 33R-9221, is also available for use as a blocking control in assays to test for specificity of this SMPX antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPX antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPX (Small Muscle Protein, X-Linked (SMPX))
- Andere Bezeichnung
- SMPX (SMPX Produkte)
- Hintergrund
- SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.
- Molekulargewicht
- 9 kDa (MW of target protein)
-