SARDH Antikörper (Middle Region)

Produktnummer ABIN629761

Produktdetails anti-SARDH Antikörper

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Ratte, Human, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SARDH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SARDH antibody was raised against the middle region of SARDH

Aufreinigung: Purified

Immunogen: SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SARDH Blocking Peptide, catalog no. 33R-1982, is also available for use as a blocking control in assays to test for specificity of this SARDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SARDH

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Andere Bezeichnung: SARDH (SARDH Produkte)

Synonyme: BPR-2 antikoerper, DMGDHL1 antikoerper, SAR antikoerper, SARD antikoerper, SDH antikoerper, zgc:56363 antikoerper, sarcosine dehydrogenase antikoerper, sarcosine dehydrogenase, mitochondrial antikoerper, Sarcosine dehydrogenase antikoerper, SARDH antikoerper, SAV_6951 antikoerper, LOC5565677 antikoerper, LOC5572760 antikoerper, SDH antikoerper, NGR_b16520 antikoerper, Sinme_2254 antikoerper, sardh antikoerper, Sardh antikoerper

Hintergrund: The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.

Molekulargewicht: 67 kDa (MW of target protein)