DECR2 Antikörper (N-Term)

Produktnummer ABIN629763

Produktdetails anti-DECR2 Antikörper

Target: DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DECR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DECR2 antibody was raised against the N terminal of DECR2

Aufreinigung: Purified

Immunogen: DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DECR2 Blocking Peptide, catalog no. 33R-5726, is also available for use as a blocking control in assays to test for specificity of this DECR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DECR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DECR2

Target: DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))

Andere Bezeichnung: DECR2 (DECR2 Produkte)

Synonyme: PDCR antikoerper, SDR17C1 antikoerper, zC153C20.5 antikoerper, zgc:85626 antikoerper, Dcrakl antikoerper, putativeperoxisomal24-dienoyl-CoAreductase antikoerper, 2,4-dienoyl-CoA reductase 2 antikoerper, 2,4-dienoyl CoA reductase 2, peroxisomal antikoerper, 2,4-dienoyl-CoA reductase 2 L homeolog antikoerper, 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal antikoerper, DECR2 antikoerper, decr2 antikoerper, decr2.L antikoerper, Decr2 antikoerper

Hintergrund: DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Molekulargewicht: 32 kDa (MW of target protein)