ALT Antikörper
-
- Target Alle ALT Antikörper anzeigen
- ALT (Alanine Aminotransferase (ALT))
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
- Top Product
- Discover our top product ALT Primärantikörper
-
anti-Alanine Aminotransferase (ALT) (AA 147-263) antibody
ALT Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Alanine Aminotransferase (ALT) (AA 367-480) antibodyALT Reaktivität: Human WB, ELISA, ICC, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Alanine Aminotransferase (ALT) (AA 143-417) antibodyALT Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Alanine Aminotransferase (ALT) (AA 581-738) antibodyALT Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Alanine Aminotransferase (ALT) (AA 2-496) antibodyALT Reaktivität: Human WB, IHC, ELISA, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Alanine Aminotransferase (ALT) (AA 255-492) antibodyALT Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal 11#-7 unconjugated
anti-Alanine Aminotransferase (ALT) (AA 255-492) antibodyALT Reaktivität: Human WB, ELISA, ICC, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Alanine Aminotransferase (ALT) (AA 118-144), (N-Term) antibodyALT Reaktivität: Human, Ratte, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB20083 unconjugated
anti-Alanine Aminotransferase (ALT) (AA 1-496) antibodyALT Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4E2 unconjugated
anti-Alanine Aminotransferase (ALT) (AA 1-496) antibodyALT Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPT Blocking Peptide, catalog no. 33R-8167, is also available for use as a blocking control in assays to test for specificity of this GPT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALT (Alanine Aminotransferase (ALT))
- Andere Bezeichnung
- GPT (ALT Produkte)
- Hintergrund
- GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
- Molekulargewicht
- 55 kDa (MW of target protein)
-
