ALT Antikörper

Produktnummer ABIN629766

Produktdetails anti-ALT Antikörper

Target: ALT (Alanine Aminotransferase (ALT))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPT Blocking Peptide, catalog no. 33R-8167, is also available for use as a blocking control in assays to test for specificity of this GPT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALT

Target: ALT (Alanine Aminotransferase (ALT))

Andere Bezeichnung: GPT (ALT Produkte)

Synonyme: AAT1 antikoerper, ALT1 antikoerper, GPT1 antikoerper, GPT antikoerper, Gpt1 antikoerper, An11g02620 antikoerper, AO090003000164 antikoerper, 233.t00009 antikoerper, 24.t00016 antikoerper, 1300007J06Rik antikoerper, 2310022B03Rik antikoerper, ALT antikoerper, Gpt-1 antikoerper, AU021132 antikoerper, Dpagt2 antikoerper, Gnpta antikoerper, gpt antikoerper, ALANINE AMINOTRANSFERAS antikoerper, AtAlaAT1 antikoerper, AtAlaATc antikoerper, T13M22.3 antikoerper, T13M22_3 antikoerper, alanine aminotransferas antikoerper, glutamic--pyruvic transaminase antikoerper, glutamic-pyruvate transaminase (alanine aminotransferase) antikoerper, alanine aminotransferase antikoerper, alanine aminotransferase 1 antikoerper, glutamic pyruvic transaminase, soluble antikoerper, dolichyl-phosphate (UDP-N-acetylglucosamine) acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) antikoerper, alanine aminotransferase 2-like antikoerper, Alanine aminotransferase 1, mitochondrial antikoerper, GPT antikoerper, Gpt antikoerper, Tb927.1.3950 antikoerper, ANI_1_368094 antikoerper, AOR_1_284154 antikoerper, ALAT_1 antikoerper, ALAAT1 antikoerper, EHI_159710 antikoerper, EHI_096750 antikoerper, LOC5572541 antikoerper, ALAT antikoerper, AAT2 antikoerper, Dpagt1 antikoerper, LOC100537633 antikoerper, AlaAT1 antikoerper

Hintergrund: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Molekulargewicht: 55 kDa (MW of target protein)