SGPP2 Antikörper (C-Term)

Produktnummer ABIN629768

Produktdetails anti-SGPP2 Antikörper

Target: SGPP2 (Sphingosine-1-Phosphate Phosphatase 2 (SGPP2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SGPP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SGPP2 antibody was raised against the C terminal of SGPP2

Aufreinigung: Purified

Immunogen: SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGPP2 Blocking Peptide, catalog no. 33R-8562, is also available for use as a blocking control in assays to test for specificity of this SGPP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGPP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SGPP2

Target: SGPP2 (Sphingosine-1-Phosphate Phosphatase 2 (SGPP2))

Andere Bezeichnung: SGPP2 (SGPP2 Produkte)

Synonyme: SPP2 antikoerper, RGD1565739 antikoerper, SPPase2 antikoerper, Spp2 antikoerper, sphingosine-1-phosphate phosphatase 2 antikoerper, sphingosine-1-phosphate phosphotase 2 antikoerper, SGPP2 antikoerper, Sgpp2 antikoerper

Hintergrund: In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).

Molekulargewicht: 37 kDa (MW of target protein)