C1orf33 Antikörper
-
- Target Alle C1orf33 (MRTO4) Antikörper anzeigen
- C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C1orf33 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV
- Top Product
- Discover our top product MRTO4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MRTO4 Blocking Peptide, catalog no. 33R-8557, is also available for use as a blocking control in assays to test for specificity of this MRTO4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRTO4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))
- Andere Bezeichnung
- MRTO4 (MRTO4 Produkte)
- Synonyme
- mrt4 antikoerper, wu:fb71a02 antikoerper, zgc:110388 antikoerper, C1orf33 antikoerper, MRT4 antikoerper, dJ657E11.4 antikoerper, RGD1311709 antikoerper, 2610012O22Rik antikoerper, Mg684 antikoerper, Mrt4 antikoerper, MRT4 homolog, ribosome maturation factor L homeolog antikoerper, MRT4 homolog, ribosome maturation factor antikoerper, mRNA turnover 4, ribosome maturation factor antikoerper, mrto4.L antikoerper, mrto4 antikoerper, MRTO4 antikoerper, Mrto4 antikoerper
- Hintergrund
- MRTO4 is a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.
- Molekulargewicht
- 27 kDa (MW of target protein)
-