EEF1G Antikörper (N-Term)

Produktnummer ABIN629773

Produktdetails anti-EEF1G Antikörper

Target: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF1G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EEF1 G antibody was raised against the N terminal of EEF1

Aufreinigung: Purified

Immunogen: EEF1 G antibody was raised using the N terminal of EEF1 corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF1G Blocking Peptide, catalog no. 33R-1044, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EEF1G

Target: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Andere Bezeichnung: EEF1G (EEF1G Produkte)

Synonyme: EF1G antikoerper, GIG35 antikoerper, eEF-1 gamma antikoerper, db03h10 antikoerper, fk76a09 antikoerper, mg:db03h10 antikoerper, wu:fk76a09 antikoerper, 2610301D06Rik antikoerper, AA407312 antikoerper, eef1g antikoerper, ef1g antikoerper, gig35 antikoerper, eukaryotic translation elongation factor 1 gamma antikoerper, eukaryotic translation elongation factor 1 gamma L homeolog antikoerper, eukaryotic translation elongation factor 1 gamma S homeolog antikoerper, EEF1G antikoerper, eef1g antikoerper, Eef1g antikoerper, eef1g.L antikoerper, eef1g.S antikoerper, EHI_119540 antikoerper, CMU_014590 antikoerper

Hintergrund: EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Molekulargewicht: 50 kDa (MW of target protein)