FNTA Antikörper (C-Term)
-
- Target Alle FNTA Antikörper anzeigen
- FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FNTA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FNTA antibody was raised against the C terminal of FNTA
- Aufreinigung
- Purified
- Immunogen
- FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV
- Top Product
- Discover our top product FNTA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FNTA Blocking Peptide, catalog no. 33R-2083, is also available for use as a blocking control in assays to test for specificity of this FNTA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))
- Andere Bezeichnung
- FNTA (FNTA Produkte)
- Synonyme
- ATFTA antikoerper, FARNESYLTRANSFERASE A antikoerper, FARNESYLTRANSFERASE SUBUNIT A antikoerper, PFT/PGGT-IALPHA antikoerper, PLP antikoerper, PLURIPETALA antikoerper, farnesyltransferase A antikoerper, FPTA antikoerper, PGGT1A antikoerper, PTAR2 antikoerper, PFAS antikoerper, FTA antikoerper, farnesyltransferase A antikoerper, farnesyltransferase, CAAX box, alpha antikoerper, FTA antikoerper, FNTA antikoerper, Fnta antikoerper
- Hintergrund
- Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling
-