SEPHS1 Antikörper (C-Term)

Produktnummer ABIN629776

Produktdetails anti-SEPHS1 Antikörper

Target: SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEPHS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SEPHS1 antibody was raised against the C terminal of SEPHS1

Aufreinigung: Purified

Immunogen: SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEPHS1 Blocking Peptide, catalog no. 33R-7181, is also available for use as a blocking control in assays to test for specificity of this SEPHS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPHS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEPHS1

Target: SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))

Andere Bezeichnung: SEPHS1 (SEPHS1 Produkte)

Hintergrund: SEPHS1 is an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons.

Molekulargewicht: 43 kDa (MW of target protein)