SEPHS1 Antikörper (C-Term)
-
- Target Alle SEPHS1 Antikörper anzeigen
- SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEPHS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SEPHS1 antibody was raised against the C terminal of SEPHS1
- Aufreinigung
- Purified
- Immunogen
- SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
- Top Product
- Discover our top product SEPHS1 Primärantikörper
-
anti-Selenophosphate Synthetase 1 (SEPHS1) (AA 1-392) antibody
SEPHS1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) (AA 1-392) antibodySEPHS1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) antibodySEPHS1 Reaktivität: Human, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) (AA 1-96) antibodySEPHS1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3G3 unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) antibodySEPHS1 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) (AA 2-100) antibodySEPHS1 Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) antibodySEPHS1 Reaktivität: Human, Maus IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) (AA 1-96) antibodySEPHS1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) (AA 1-392) antibodySEPHS1 Reaktivität: Human ELISA Wirt: Maus Monoclonal 4D3-6A2 unconjugated
anti-Selenophosphate Synthetase 1 (SEPHS1) (C-Term) antibodySEPHS1 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Meerschweinchen, Hund, Schwein, Fledermaus, Huhn, Affe, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEPHS1 Blocking Peptide, catalog no. 33R-7181, is also available for use as a blocking control in assays to test for specificity of this SEPHS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPHS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))
- Andere Bezeichnung
- SEPHS1 (SEPHS1 Produkte)
- Synonyme
- Sps1 antikoerper, SEPHS1 antikoerper, SEPHS1_tv1 antikoerper, 1110046B24Rik antikoerper, AA589574 antikoerper, AI505014 antikoerper, AW111620 antikoerper, SELD antikoerper, SPS antikoerper, SPS1 antikoerper, wu:fc49b09 antikoerper, zgc:55304 antikoerper, selenophosphate synthetase 1 antikoerper, selenophosphate synthetase 1 L homeolog antikoerper, sucrose phosphate synthase 1 antikoerper, sucrose-phosphate synthase antikoerper, SEPHS1 antikoerper, sephs1 antikoerper, Sps1 antikoerper, Sephs1 antikoerper, sephs1.L antikoerper, sps1 antikoerper, sps antikoerper
- Hintergrund
- SEPHS1 is an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons.
- Molekulargewicht
- 43 kDa (MW of target protein)
-
