GMPPB Antikörper (C-Term)

Produktnummer ABIN629777

Produktdetails anti-GMPPB Antikörper

Target: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMPPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GMPPB antibody was raised against the C terminal of GMPPB

Aufreinigung: Purified

Immunogen: GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMPPB Blocking Peptide, catalog no. 33R-7838, is also available for use as a blocking control in assays to test for specificity of this GMPPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMPPB

Target: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Andere Bezeichnung: GMPPB (GMPPB Produkte)

Synonyme: MDDGA14 antikoerper, MDDGB14 antikoerper, MDDGC14 antikoerper, AI317178 antikoerper, E430010H19 antikoerper, RGD1560458 antikoerper, gmppl antikoerper, zgc:92026 antikoerper, GMPPB antikoerper, gmppb antikoerper, gmppb-a antikoerper, gmppb-b antikoerper, GDP-mannose pyrophosphorylase B antikoerper, GDP-mannose pyrophosphorylase B L homeolog antikoerper, GDP-mannose pyrophosphorylase B S homeolog antikoerper, GMPPB antikoerper, Gmppb antikoerper, gmppb antikoerper, LOAG_13550 antikoerper, gmppb.L antikoerper, gmppb.S antikoerper

Hintergrund: GMPPB is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Molekulargewicht: 43 kDa (MW of target protein)