TKTL2 Antikörper (C-Term)
-
- Target Alle TKTL2 Antikörper anzeigen
- TKTL2 (Transketolase-Like 2 (TKTL2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TKTL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TKTL2 antibody was raised against the C terminal of TKTL2
- Aufreinigung
- Purified
- Immunogen
- TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG
- Top Product
- Discover our top product TKTL2 Primärantikörper
-
anti-Transketolase-Like 2 (TKTL2) (AA 59-120) antibody
TKTL2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5E2 unconjugated
anti-Transketolase-Like 2 (TKTL2) (AA 1-300) antibodyTKTL2 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Transketolase-Like 2 (TKTL2) (AA 43-71), (N-Term) antibodyTKTL2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37372 unconjugated
anti-Transketolase-Like 2 (TKTL2) (AA 551-600) antibodyTKTL2 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Fledermaus, Hamster, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transketolase-Like 2 (TKTL2) (AA 38-87) antibodyTKTL2 Reaktivität: Human, Rind (Kuh), Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transketolase-Like 2 (TKTL2) (C-Term) antibodyTKTL2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Hund, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transketolase-Like 2 (TKTL2) (N-Term) antibodyTKTL2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Hund, Pferd, Kaninchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TKTL2 Blocking Peptide, catalog no. 33R-8786, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TKTL2 (Transketolase-Like 2 (TKTL2))
- Andere Bezeichnung
- TKTL2 (TKTL2 Produkte)
- Synonyme
- TKTL2 antikoerper, 4933401I19Rik antikoerper, RGD1304767 antikoerper, transketolase like 2 antikoerper, transketolase-like 2 L homeolog antikoerper, transketolase-like 2 antikoerper, TKTL2 antikoerper, tktl2.L antikoerper, Tktl2 antikoerper
- Hintergrund
- TKTL2 plays an essential role in total transketolase activity and cell proliferation in cancer cells. After transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. TKTL2 may also play a pivotal role in carcinogenesis
- Molekulargewicht
- 68 kDa (MW of target protein)
-
