TKTL2 Antikörper (C-Term)
-
- Target Alle TKTL2 Antikörper anzeigen
- TKTL2 (Transketolase-Like 2 (TKTL2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TKTL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TKTL2 antibody was raised against the C terminal of TKTL2
- Aufreinigung
- Purified
- Immunogen
- TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG
- Top Product
- Discover our top product TKTL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TKTL2 Blocking Peptide, catalog no. 33R-8786, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TKTL2 (Transketolase-Like 2 (TKTL2))
- Andere Bezeichnung
- TKTL2 (TKTL2 Produkte)
- Hintergrund
- TKTL2 plays an essential role in total transketolase activity and cell proliferation in cancer cells. After transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. TKTL2 may also play a pivotal role in carcinogenesis
- Molekulargewicht
- 68 kDa (MW of target protein)
-