TIGD3 Antikörper (N-Term)

Produktnummer ABIN629782

Produktdetails anti-TIGD3 Antikörper

Target: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TIGD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TIGD3 antibody was raised against the N terminal of TIGD3

Aufreinigung: Purified

Immunogen: TIGD3 antibody was raised using the N terminal of TIGD3 corresponding to a region with amino acids NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIGD3 Blocking Peptide, catalog no. 33R-6738, is also available for use as a blocking control in assays to test for specificity of this TIGD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TIGD3

Target: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Andere Bezeichnung: TIGD3 (TIGD3 Produkte)

Synonyme: tigger transposable element derived 3 antikoerper, TIGD3 antikoerper, Tigd3 antikoerper

Hintergrund: TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.

Molekulargewicht: 52 kDa (MW of target protein)