SLC38A4 Antikörper (Middle Region)

Produktnummer ABIN629787

Produktdetails anti-SLC38A4 Antikörper

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), C. elegans, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC38A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLC38 A4 antibody was raised against the middle region of SLC38 4

Aufreinigung: Purified

Immunogen: SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A4 Blocking Peptide, catalog no. 33R-4755, is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC38A4

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Andere Bezeichnung: SLC38A4 (SLC38A4 Produkte)

Synonyme: wu:fd51c05 antikoerper, zgc:103694 antikoerper, zgc:113830 antikoerper, SLC38A4 antikoerper, ATA3 antikoerper, SNAT4 antikoerper, NAT3 antikoerper, PAAT antikoerper, 1110012E16Rik antikoerper, 1700012A18Rik antikoerper, Ata3 antikoerper, mATA3 antikoerper, mNAT3 antikoerper, solute carrier family 38, member 4 antikoerper, solute carrier family 38 member 4 antikoerper, slc38a4 antikoerper, SLC38A4 antikoerper, Slc38a4 antikoerper

Hintergrund: SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molekulargewicht: 17 kDa (MW of target protein)