SLC38A4 Antikörper (Middle Region)

Produktnummer ABIN629787

Produktdetails anti-SLC38A4 Antikörper

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), C. elegans, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC38A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLC38 A4 antibody was raised against the middle region of SLC38 4

Aufreinigung: Purified

Immunogen: SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A4 Blocking Peptide, catalog no. 33R-4755, is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC38A4

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Andere Bezeichnung: SLC38A4 (SLC38A4 Produkte)

Hintergrund: SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molekulargewicht: 17 kDa (MW of target protein)